Ot-cholet.fr valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title Surprenant Choletais - L'Office de Tourisme de Cholet et du Choletais
Description Bienvenue sur le site officiel de Surprenant Choletais Activités de loisirs, idées de sorties, agenda, restaurants, hébergements, billetteries, boutique... Tout est là !
Keywords N/A
Server Information
WebSite ot-cholet favicon www.ot-cholet.fr
Host IP 176.31.230.127
Location France
Related Websites
Site Rank
cholet.fr #6,786,679
anjou-tourisme.com #1,128,969
More to Explore
otk-expert.com
otoboyasizgocukduzeltme.com
otomatikkepenktamiriaydinefeler.wordpress.com
otpusk21.ru
overboard.eu
overboard.sg
packcenter.info
paimosubroto.blogspot.com
pak-shoo.com
palmvalleyoutdoors.com
safirparand.com
sam-network.org
Ot-cholet.fr Valuation
US$3,472
Last updated: Jan 18, 2020

Ot-cholet.fr has global traffic rank of 9,698,683. Ot-cholet.fr has an estimated worth of US$ 3,472, based on its estimated Ads revenue. Ot-cholet.fr receives approximately 317 unique visitors each day. Its web server is located in France, with IP address 176.31.230.127. According to SiteAdvisor, ot-cholet.fr is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$3,472
Daily Ads Revenue US$1
Monthly Ads Revenue US$57
Yearly Ads Revenue US$694
Daily Unique Visitors 317
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 9,698,683
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
ot-cholet.fr A 3599 IP: 176.31.230.127
ot-cholet.fr MX 3599 Priority: 0
Target: otcholet-fr0e.mail.protection.outlook.com.
ot-cholet.fr NS 3599 Target: ns1.ingenie.fr.
ot-cholet.fr NS 3599 Target: ns2.ingenie.fr.
ot-cholet.fr TXT 3599 TXT: MS=ms95788666
ot-cholet.fr TXT 3599 TXT: v=spf1 include:spf.protection.outlook.com include:spf.ingenie.fr -all
ot-cholet.fr SOA 3599 MNAME: ns1.ingenie.fr.
RNAME: postmaster.ingenie.fr.
Serial: 2019112001
Refresh: 3600
Retry: 900
Expire: 2419200
Minimum TTL: 600
HTTP Headers
HTTP/1.1 301 Moved Permanently
Date: Sat, 18 Jan 2020 08:59:42 GMT
Server: Apache
Location: https://ot-cholet.fr/
Content-Length: 0
Content-Type: text/html; charset=ISO-8859-15

HTTP/1.1 301 Moved Permanently
Date: Sat, 18 Jan 2020 08:59:42 GMT
Server: Apache
Location: https://www.ot-cholet.fr/
Content-Length: 233
Content-Type: text/html; charset=iso-8859-1

HTTP/1.1 200 OK
Date: Sat, 18 Jan 2020 08:59:43 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Set-Cookie: PHPSESSID=atr0b33h8dkv0hri5u3l8e4qv2; path=/
Vary: Accept-Encoding
Access-Control-Allow-Origin: *
Access-Control-Allow-Headers: x-requested-with
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8

Ot-cholet.fr Whois Information
domain:      ot-cholet.fr
status:      ACTIVE
hold:        NO
holder-c:    ODTD1008-FRNIC
admin-c:     OVH5-FRNIC
tech-c:      OVH5-FRNIC
zone-c:      NFC1-FRNIC
nsl-id:      NSL106268-FRNIC
registrar:   OVH
Expiry Date: 2020-07-04T22:07:02Z
created:     1998-06-15T22:00:00Z
last-update: 2019-07-04T22:35:02Z
source:      FRNIC

ns-list:     NSL106268-FRNIC
nserver:     ns1.ingenie.fr
nserver:     ns2.ingenie.fr
source:      FRNIC

registrar:   OVH
type:        Isp Option 1
address:     2 Rue Kellermann
address:     59100 ROUBAIX
country:     FR
phone:       +33 8 99 70 17 61
fax-no:      +33 3 20 20 09 58
e-mail:      support@ovh.net
website:     http://www.ovh.com
anonymous:   NO
registered:  1999-10-21T12:00:00Z
source:      FRNIC

nic-hdl:     ODTD1008-FRNIC
type:        ORGANIZATION
contact:     OFFICE DE TOURISME DU CHOLETAIS
address:     14, avenue Maudet
address:     49306 Cholet
country:     FR
phone:       +33.241498000
e-mail:      op7ga4r8l7u8708jihvi@q.o-w-o.info
registrar:   OVH
changed:     2018-06-12T05:09:40Z nic@nic.fr
anonymous:   NO
obsoleted:   NO
eligstatus:  not identified
reachstatus: not identified
source:      FRNIC

nic-hdl:     OVH5-FRNIC
type:        ROLE
contact:     OVH NET
address:     OVH
address:     140, quai du Sartel
address:     59100 Roubaix
country:     FR
phone:       +33 8 99 70 17 61
e-mail:      tech@ovh.net
trouble:     Information: http://www.ovh.fr
trouble:     Questions:  mailto:tech@ovh.net
trouble:     Spam: mailto:abuse@ovh.net
admin-c:     OK217-FRNIC
tech-c:      OK217-FRNIC
notify:      tech@ovh.net
registrar:   OVH
changed:     2006-10-11T08:41:58Z tech@ovh.net
anonymous:   NO
obsoleted:   NO
eligstatus:  not identified
reachstatus: not identified
source:      FRNIC

nic-hdl:     OVH5-FRNIC
type:        ROLE
contact:     OVH NET
address:     OVH
address:     140, quai du Sartel
address:     59100 Roubaix
country:     FR
phone:       +33 8 99 70 17 61
e-mail:      tech@ovh.net
trouble:     Information: http://www.ovh.fr
trouble:     Questions:  mailto:tech@ovh.net
trouble:     Spam: mailto:abuse@ovh.net
admin-c:     OK217-FRNIC
tech-c:      OK217-FRNIC
notify:      tech@ovh.net
registrar:   OVH
changed:     2006-10-11T08:41:58Z tech@ovh.net
anonymous:   NO
obsoleted:   NO
eligstatus:  not identified
reachstatus: not identified
source:      FRNIC